HORDB

General Information

ID: hor006258
Uniprot ID: Q13519
Protein name: Neuropeptide 2
Gene name: PNOC
Organism: Homo sapiens (Human)
Family: Opioid neuropeptide precursor family
Source: Human
Expression: Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation.
Disease: Diseases associated with PNOC include Postpartum Depression and Neonatal Abstinence Syndrome.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001515 opioid peptide activity; GO:0005184 neuropeptide hormone activity; GO:0031628 opioid receptor binding; GO:0048018 receptor ligand activity
GO BP: GO:0007165 signal transduction; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007270 neuron-neuron synaptic transmission; GO:0007565 female pregnancy; GO:0007600 sensory perception; GO:0019233 sensory perception of pain
GO CC: GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043679 axon terminus; GO:0097060 synaptic membrane

Sequence Information

Sequence: FSEFMRQYLVLSMQSSQ
Length: 17
Propeptide: MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Signal peptide: MKVLLCDLLLLSLFSSVFS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development.
Mechanism: NA
Cross BBB: NA
Target: OPRL1
Target Unid: P41146
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q13519-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006258_AF2.pdb

hor006258_ESM.pdb

Physical Information

Mass:	236694	Formula:	C92H141N23O28S2
Absent amino acids:	ACDGHIKNPTW	Common amino acids:	S
pI:	6.4	Basic residues:	1
Polar residues:	5	Hydrophobic residues:	5
Hydrophobicity:	-10.59	Boman Index:	-2755
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	62.94
Instability Index:	6727.06	Extinction Coefficient cystines:	1490
Absorbance 280nm:	93.13

Literature

PubMed ID: 8710928
Title: Structure, tissue distribution, and chromosomal localization of the prepronociceptin gene.
PubMed ID: 8710930
Title: Primary structure and tissue distribution of the orphanin FQ precursor.
PubMed ID: 12950177
Title: Human neutrophils as a source of nociceptin: a novel link between pain and inflammation.
PubMed ID: 14702039
Title: Complete sequencing and characterization of 21,243 full-length human cDNAs.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 9168905
Title: Solution conformation of nociceptin.